Results for : sofia 29

JasmineRosepriv - update #3 - IMG 1475 - Apr 29, 2025

1min 26sec - 1080p -   GOLD

Cassy latina couple - update #3 - 1000034199 - May 29, 2025

45sec - 1080p -   GOLD

Alinemilf - update #263 - Lv 0 20250428180950 - Apr 29, 2025

6min - 480p -   GOLD

Mmv xxx - update #364 - XH 30129 Pain Date VA12 SH - Dec 29, 2025

20 109min - 1080p -   GOLD

Chapter 29, the more we are, the better we don't pass it

2 5min - 720p -   GOLD

Hotwife Steffi Pussy Dance PMV 29

10min - 1080p -   GOLD

Latina & Blondes 69 Orgasm Race

20min - 1080p -   GOLD

To fulfill a fantasy, Cat In Mini, 29, strips off!

36 36min - 4K -   GOLD

Mistressrola - update #5 - 4772587437305793732 - Nov 29, 2025

5 10min - 720p -   GOLD

Hunghank69 - update #29 - D1LVPointplateshimmyweirdfaceweirderface - Jul 29, 2025

284 19sec - 1080p -   GOLD

Janohot7286 - update #1 - 20250816085606 45480672 record - Aug 29, 2025

5min - 1080p -   GOLD

Animated 3D Card Sex- Away From Home #29 Porn Game

5 45min - 1080p -   GOLD

Blonde Bimbo Brat Sucks Big Cock- Sexbot #29 Gameplay

25 38min - 720p -   GOLD

FashionBusiness - Kiss Pussy E3 #29

10min - 1080p -   GOLD

All The Way Down Deepthroaters Volume 29 - 3 to the Balls Deepthroat Blowjobs - Kat Stevens, Leda Lotharia, Sheena Ryder

16 79min - 1080p -   GOLD

Not so wise, the beautiful Lavyana, 29 years old...

22 37min - 4K -   GOLD

Defrancesca Meaty Pussy Solo

16min - 1080p -   GOLD

Part 2 <Conscious Career Wife> - She's in full-blown heat and becoming a female! Sucking the pole, balls, and everything in between!

13 14min - 1080p -   GOLD

Part 1 <Conscious Career Wife >> She's in full-blown heat and becoming a female! Sucking the pole, balls, and everything in between!

75 64min - 1080p -   GOLD

Bad ass babe deepthroats two huge hard dicks and gets double penetrated fucking

23 141min - 1080p -   GOLD

Pretty teen gets introduced into a wild fucking with huge dick and cumshot

49 19min - 1080p -   GOLD

Two girls getting drilled outdoor by two old men hard dick and moans for a good fuck

26 95min - 1080p -   GOLD

Busty Milf Stepmom Shares Bed With Her Stepson On a Sex Vacation! - Midnight Paradise

76 18min - 1080p -   GOLD

Tight Pink Workout Shorts with Big Tattooed Tits bulging

25 7min - 1080p -   GOLD

Alinemilf - update #298 - VID 20250710 161427 683.mp4 - Jul 11, 2025

11 20min - 720p -   GOLD

"Busty Applicant Pleasant Exam": Stretches Gaping Pussy With Trainer Big Cock. POV

115 29min - 4K -   GOLD

Sofia Rose Gets Bent Over And Jackhammered By Rome!

11 30min - 1080p -   GOLD

I rammed my whole cock all the way into shy Sofia

5min - 1080p -   GOLD

From Treadmill To Trembling: Sofia Rose Begs For Rome Major’s Protein!

2 30min - 1080p -   GOLD

Sofia Rose's Gym Resolution Leads To Rome Major's BBC Cardio!

30min - 1080p -   GOLD

Sofia stretches outdoors with her ass and pussy exposed

34 10min - 4K -   GOLD

Voluptuous Sofia Sucks Rome’s Dick Before Hard Doggy Drills!

21 81% 29min - 720p -   GOLD